PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cucsa.306580.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
Family MYB
Protein Properties Length: 241aa    MW: 28755.5 Da    PI: 8.3781
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cucsa.306580.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding44.43.7e-141461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     rg+W +eEd +l   v+++G + W++Ia+  g+ R++k+c+ rw++yl
   Cucsa.306580.1 14 RGPWLEEEDRRLTIFVTRMGERKWDLIAKASGLERSGKSCRFRWLNYL 61
                     89********************************************97 PP

2Myb_DNA-binding48.22.4e-1567112148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      r+r   eE+e++++++k++G++ W++Ia+ ++ gRt++++k++w+++l
   Cucsa.306580.1  67 RDRINSEEEEIILKLHKKWGNK-WSRIAQWLP-GRTDNEIKNYWRSHL 112
                      567789****************.*********.************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129423.664965IPR017930Myb domain
SuperFamilySSF466899.9E-2611108IPR009057Homeodomain-like
SMARTSM007171.6E-101363IPR001005SANT/Myb domain
PfamPF002491.1E-111461IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.1E-191568IPR009057Homeodomain-like
CDDcd001671.54E-61661No hitNo description
PROSITE profilePS5129418.47366116IPR017930Myb domain
SMARTSM007171.6E-1266114IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.605.4E-2269115IPR009057Homeodomain-like
PfamPF002496.2E-1372112IPR001005SANT/Myb domain
CDDcd001674.03E-973112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010200Biological Processresponse to chitin
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 241 aa     Download sequence    Send to blast
MASQSALQTE RLRRGPWLEE EDRRLTIFVT RMGERKWDLI AKASGLERSG KSCRFRWLNY  60
LRPNLKRDRI NSEEEEIILK LHKKWGNKWS RIAQWLPGRT DNEIKNYWRS HLRKKFPIQL  120
EGNKVEQRKE DKVSLKKCGL LVSPIRHDHN ERKDIPSCNI SYNHFDFGFS NLAITSSPYE  180
IRVSNWISHQ LTNEKPEVND HHEDCNSLDF CFCYPNMNFA ERDDMTDHFW DSLASLWDME  240
*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1msf_C2e-26121162105C-Myb DNA-Binding Domain
1mse_C2e-26121162105C-Myb DNA-Binding Domain
1gv2_A3e-26121162105MYB PROTO-ONCOGENE PROTEIN
1h89_C6e-26411649159MYB PROTO-ONCOGENE PROTEIN
1h88_C6e-26411649159MYB PROTO-ONCOGENE PROTEIN
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00406DAPTransfer from AT3G53200Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN6818411e-157LN681841.1 Cucumis melo genomic scaffold, anchoredscaffold00011.
GenBankLN7132581e-157LN713258.1 Cucumis melo genomic chromosome, chr_4.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004137980.11e-180PREDICTED: myb-related protein 340
TrEMBLA0A0A0LB541e-144A0A0A0LB54_CUCSA; Uncharacterized protein
STRINGPOPTR_0006s12400.16e-63(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF131692631
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G53200.15e-49myb domain protein 27